SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZJH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZJH3
Domain Number 1 Region: 211-273
Classification Level Classification E-value
Superfamily Homeodomain-like 1.92e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 93-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000167
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 62-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000111
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZJH3
Sequence length 347
Comment (tr|H0ZJH3|H0ZJH3_TAEGU) LIM homeobox 8 {ECO:0000313|Ensembl:ENSTGUP00000010741} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LHX8 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MYWKSDPMFVCRLEDKDLPALGGPAEKASPTTADEDSCSSSAALSPSSSPRSMASGSGCA
PGKCVCSSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYF
RRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVH
YDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNN
PDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSTAPVTAVQPSRLSPPMLEE
MAYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPLSHT
Download sequence
Identical sequences H0ZJH3
ENSTGUP00000010741 XP_002189228.1.42559 ENSTGUP00000010741 59729.ENSTGUP00000010741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]