SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZJM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZJM2
Domain Number 1 Region: 6-71
Classification Level Classification E-value
Superfamily UBA-like 0.00000000153
Family UBA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZJM2
Sequence length 551
Comment (tr|H0ZJM2|H0ZJM2_TAEGU) Spermatogenesis associated serine rich 2 like {ECO:0000313|Ensembl:ENSTGUP00000010791} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=SPATS2L OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MAEVNSPVNIKEKINAIRSIVPNKSNNEIVLVLQQFDNNVDKAVQAFMDGDATQVLKEWN
MTGKKKNNRRKRSKSKQHQGNKDSKNKNSGPEKASQEPQRINDCHMNGCPKDNSGRGSAN
QKLETTSLEKKSSTFRSVPLTESTFPTGKRERQRVSVESNPKTVNGVEQHEPLQSPVQLQ
CNLGRPKSSSVKSPNVSTQLETKTDDSVKKRGPNIEKSVKDLQRCTVSLTRYRVMIKEEV
DNSVKKIKAVFAELHSCIVDKEVSLMAEIDKVKEEAMEILTARQKKAEELKRLADLASQM
AEAQLSELRAEIKHFVSERKYDEELGRSARFSCDTEQLKTQIQLCGEISHPKNSYSSRTP
CSLLLSSMTSHATAGKQNTHNRKSSSNAKNSDKTASSKVQSYPSSNPTESSSQGVPTNKH
NGPSNQRRRFNPQHQNMRLNGSHKSQGASNEADQNTKSGSKSEHRRQQHNSFRSKNKGAV
KNQEPSTTARTTENPTHSEKSRRKHHTPDTAEHRPFQGSVGRVSQCNLCPARMEVSADAT
VLSVPAVTLVA
Download sequence
Identical sequences H0ZJM2
ENSTGUP00000010791 ENSTGUP00000010791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]