SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZK46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZK46
Domain Number 1 Region: 326-499,539-624,653-681,749-859
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.46e-82
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0008
Further Details:      
 
Domain Number 2 Region: 183-290
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-34
Family Zf-UBP 0.00000343
Further Details:      
 
Domain Number 3 Region: 714-765
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000319
Family UBA domain 0.01
Further Details:      
 
Weak hits

Sequence:  H0ZK46
Domain Number - Region: 37-89
Classification Level Classification E-value
Superfamily RING/U-box 0.0153
Family Zf-UBP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZK46
Sequence length 861
Comment (tr|H0ZK46|H0ZK46_TAEGU) Ubiquitinyl hydrolase 1 {ECO:0000256|SAAS:SAAS00003083} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=USP13 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MQRAALFRAGDAQMAAGDLGELLVPYMPTIRVPKSGDRVYKTECAFSYDSPDSEGGLYVC
MNTFLGFGREHMERHYRKTGQCVYLHLKRHVRQKVPGASGGALPKRRNAKLFLDLEISSD
LNSDDFEYEDEAKLVLFPDHYEISLPNIEELPALVTIACDALLSAKSPYRKQEPDSWEEE
LQASKHAKTLVQLDNGVRIPPSGWKCCRCDLRENLWLNLTDGSVLCGKWFFDGSGGNGHA
TEHYRETGYPLAVKLGTITPDGADVYSFDEEEPVLDPHIAKHLAHFGIDMLQMQVTENGL
RDNDIKPRVSEWEVIQEAGVKLKPMYGPGYTGMKNLGNSCYLNAVMQAIFSIPEFQRAYV
GNLPRIFDYSPLDPTQDFNTQMAKLGHGLLSGQYSKPPMKSELIEQVMKEEHKPQHNGIS
PRMFKAFISKGHPEFSSNRQQDAQEFFLHLINLVERNPVGSENPSDVFRFLVEERTQCCQ
SRKVRYTERVDYIMQLPVAMEAATNKDELIAYELKRREAEAARRPLPELVRAKIPFSACL
QAFSEPSNVEDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWIPKKLDVSIDM
PDFLDISHLRARGLQPGEEELPDIAPPIVIPDDPKALLFSSLLDNPNIDESSVMQLAEMG
FPLEACRKAVYYTGNLGAEVAFNWIIAHMEEPDFAEPLVIPAFGEVASSGAAALGAVGLD
NQPPEEMVAIIISMGFQRNLAIQALKATNNNLERALEWIFSHPDPEEESDPALDTMDMEN
NANANILSETGSEGPRIKDGPGRYELFGFISHMGTSTMSGHYVCHLRKEGRWVIYNDLRV
CASERPPKDLGYIYFYHRIPS
Download sequence
Identical sequences H0ZK46
ENSTGUP00000010966 ENSTGUP00000010966 59729.ENSTGUP00000010966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]