SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZKP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZKP0
Domain Number 1 Region: 227-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-77
Family Eukaryotic proteases 0.0000993
Further Details:      
 
Domain Number 2 Region: 101-207
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-30
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 2-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  H0ZKP0
Domain Number - Region: 40-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00215
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZKP0
Sequence length 485
Comment (tr|H0ZKP0|H0ZKP0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000011161} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=HABP2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
ADSCSSSPCKNGGTCEARGSGFSCRCPTPYGGTTCEKVEDTCLEKNCHFGDCLIILTPPY
FKCSCKPPYKRPSCQRASKQCSPNPCRNGGTCKRNRYRSKFTCECPEPFRGRFCEIGPND
CYEEDSSTYRGRVNQAENGRTCLHWNSHHLLDHPFNAFMEDADSYGIGEHNFCRNPDGDE
KPWCYIRKNNEVDWEYCDVSPCSGKELKATEETPTEPPTDPPEIFKTCGQPEVHRTLKKI
YGGSKATPGKHPWMASLQTRTLDGNKHFCGGVLIKSCWVLTAAHCLQEPKPNIQVVLGKQ
NLKKKEDHEQIFDAVHIVLHGKYREEPGHALYNDIALLKLQPVDGYCAVETKHVKIACVP
DFFLPAGTSCFISGWGSTETGDLSHQLLDANVKLISQRKCNEPKLHDDKLDDSMFCAGNL
RKPEIDSCEGDSGGPLTCVQNGSYYVYGLVSWGEGCGLKNKPGVYTQVTKFASWINAAIQ
SASRS
Download sequence
Identical sequences H0ZKP0
ENSTGUP00000011161 ENSTGUP00000011161 59729.ENSTGUP00000011161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]