SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZNK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZNK6
Domain Number 1 Region: 317-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 159-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 455-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.008
Further Details:      
 
Domain Number 4 Region: 283-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000457
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZNK6
Sequence length 678
Comment (tr|H0ZNK6|H0ZNK6_TAEGU) Fibulin-1 {ECO:0000256|PIRNR:PIRNR036313} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=FBLN1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
ADLSVEECCDKGVEWANKNRICASLPLISESRECSMTQVQCCRSQLQKQSCSDGLEFASA
REECDSHLPKNSTCEAEYFKTCCYCCLLGKAAQVQGQSCEPNPKIGYQCGIVFRTCCGKG
QEGIDLSISDYAPKKEPVEISKEELDQEDPYLHDGCRGGGPCSQQCRDTGSSYVCSCFVG
YQLQPDGLTCEDINECITGTHNCGIGQTCVNTLGSFRCQRDTSCGTGYELTDDSRCKDID
ECETGTHNCPPDFICQNTPGSFRCRPKLQCMSGFIQDALGNCIDINECLSANTPCPAGQI
CINTDGSFTCQRISPSCGRGYHLNEDGTRCVDVDECSSSNQPCGEGHICINAPGNYRCEC
KAGYTFDVISRTCIDINECRRYPGRLCAHKCENTPGSYYCTCTVGFKLSADGRSCEDLNE
CESNPCSQECANVYGSYQCYCRRGFQLSDIDGISCEDIDECALPTGGHICSFRCINIPGS
FQCTCPSTGYRLAPNARNCQDIDECVAENHNCSFNETCFTQGGFRCLSWICAQKLRSSTR
CVRLEKTDTIRCIKSCRPNDVSCLLDPVHTISHTVISLPTFREFTRPEEIIFLRAITPTY
PANQADIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIIGPFHAILKLEMNYVMGGV
VSHRNIVNVHIFVSEYWF
Download sequence
Identical sequences H0ZNK6
ENSTGUP00000012183 59729.ENSTGUP00000012183 ENSTGUP00000012183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]