SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZNZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZNZ6
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.49e-40
Family BM-002-like 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZNZ6
Sequence length 83
Comment (tr|H0ZNZ6|H0ZNZ6_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000012325} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=UFM1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SKVTFKVTLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQ
TAGNVFLKHGSDLRLIPRDRVGS
Download sequence
Identical sequences H0ZNZ6
59729.ENSTGUP00000012325 ENSTGUP00000012325 ENSTGUP00000012325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]