SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZPQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZPQ7
Domain Number 1 Region: 207-405
Classification Level Classification E-value
Superfamily MIR domain 2.53e-64
Family MIR domain 0.0000000564
Further Details:      
 
Domain Number 2 Region: 407-572
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.22e-56
Family IP3 receptor type 1 binding core, domain 2 0.000000227
Further Details:      
 
Domain Number 3 Region: 1133-1254
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.85e-33
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 77-190
Classification Level Classification E-value
Superfamily MIR domain 5.49e-21
Family MIR domain 0.017
Further Details:      
 
Domain Number 5 Region: 1153-1225,1253-1317,1498-1523,1888-2068
Classification Level Classification E-value
Superfamily ARM repeat 0.00000163
Family Plakophilin 1 helical region 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZPQ7
Sequence length 2671
Comment (tr|H0ZPQ7|H0ZPQ7_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000012589} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=ITPR2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SRLVDDRCVVQPEAGDLANPPKKFRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALL
KKLQHAAELEQKQNESENRKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRV
SLDAAGNEGSWFYIQPFWKLRSEGDNVVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEV
NAVNCNTSWKITLFMKFSSYRDDVLKGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLR
QSATSATSSKALWEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPHYPEGNNEG
KALRDGDLPASKKKRQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRL
RHLCTNTWVTSTSIPIDTEEERPVMLKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDAN
KVLASTVKKLENGTITQNERRFVTKLLEDLIFFVADVPNNGQEVLDVIITKPNRERQKLM
REQNILAQIFGILKAPFKDKGEGSMLRLEDLGDQRYAPYKYMLRLCYRVLRHSQQDYRKN
QEYIAKNFCIMQSQIGYDILAEDTITALLHNNRKLLEKHITAKEIETFVNLLRRNREPRF
ERFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKLVSTQMDNPLECPVISDD
IDEEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLTYYRYQLNLFARMCLDRQYL
AINQISAQLSVDLILRCMSDESLPYDLRASFCRLMLHMHVDRDPQESVVPVKYARLWTEI
PTKITIHEYDSFTDSSRNEMKTKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHL
ARNLIYFGFYSFSELLRLTRTLLAILDIVQVPISSYFERLSKFQDGGNNVMRTIHGGEMM
TQMVLSRGSVFPISTPDIQPSIHPSKQASTADSEDVIVMDTKLKIIEILQFILSVRLDYR
ISYMLSIYKREFGENTENVDCSTSSPSDTPGTASAIVPDIDEIAAQAETMFAGRKEKNAV
QLDDEGGRTFLRVLIHLIMHDYPPLLSGALHLLFKHFSQRAEVLQAFKQVQLLVSNQDVD
NYKQIKADLDQLRLTVEKSELWVEKSSNYESGEVGDNQTKGGEEPMEESNILSPIQDGTK
KPQIDSIKSNNYNIVKEILIRLSKLCVQNKKCRNQQQRLLKNMGAHLVVLDLLQIPYEKS
DEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKNLNLFLTPGLLEAETMRHIFMNNYLLCNE
ISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYVKKCQDMVMTELINGGEDVLIFYN
DRASFPVLLQMMCSERDRADESGPLAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIV
RVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYASNHIWKLFENFLVDMARVSFTXXX
XXHADTSLEKYVHEPVMSIVSGFNSPFSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPT
QKASVESCIKTLAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRMSARSGPRF
KEALGGPAWDYRNIIEKLQDVVSSLEQQFTPMMQAEFSVLVDVLHSPELLFPEGSDARIR
CGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLDKKTNFAEEGNTLRKILLYRYFKGEY
GSGMNGPLSASYSKTAQVGGGFSGQDADKSGVTMFDIQCLLDKEGASELVIDVIVNTRND
RIFSEGILLGIALLEGGNTQTQYSTYQQLKEQKKSERFFKVLYDRMKAAQQEIRSTVTVN
TIDLGSKKKEDDSDLTISVPKKRVKDSTLHLKEGMKGQLTEASSATSKAYSVYRREMDPE
TDLMGSGADAANAEEKSAEEAIMSPAIAIMQPILRFLQLLCENHNRELQNFLRHQNNKTN
YNLVCETLQFLDCICGSTTGGLGLLGLYINERNVALVNQTLESLTEYCQGPCHENQTCIA
THESNGIDIIIALILNDINPLGKYCMDLVLQLKNNASKLLLAIMESRQDSENAERILFNM
RPRELVDVMKNAYNQGLECDHEEENGDDGISPKDVGHNIYILAHQLACHNKTLQQMLKPG
SDPDEGDEALRFYAKHTAQIEIVRHDRTMEKIVFPVPNICEFLTRESKSRVFNTTERDEQ
GSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYP
FGDDGDEGTLSPLFSVLLWIAVAFCTAMLFFISKPVGIRPFLVSVILRSIYTIGLGPTLI
LLGAANLCNKIVFLVSFVGNRGTFTRGYRAVIMDMAFLYHVAYVLVCMLGLCVHEFFYSF
LLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFIMEVDRLK
IRTPAAGIGEVPTTTLTSMMGACAKENCSTSIPALNPGEEEEDGIERTCDTLLMCIVTVL
NQGLRNGGGVGDVLRKPSKDEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSE
KQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKAEHNMWHYLYFIVLVKVKDPTEYTGP
ESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQERLESTMSLVKQLSSQLAEL
KEQMTEQRKNKQRLGFLGSNTPHVNHHMPPP
Download sequence
Identical sequences H0ZPQ7
ENSTGUP00000012589 ENSTGUP00000012589 59729.ENSTGUP00000012589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]