SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZPX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZPX0
Domain Number 1 Region: 265-446
Classification Level Classification E-value
Superfamily MIR domain 1.03e-53
Family MIR domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZPX0
Sequence length 683
Comment (tr|H0ZPX0|H0ZPX0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000012653} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=POMT2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SFTIRFHRMREPPQVCWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTF
PFQKPGDRYEQHNYVGMRGFCAFLGSCLVPFAYLTVLELSKSLPAALLTAFILIFDTGCI
TLSQYILLDPILMFFLMGAVLSMVKCNSCADRPFSASWWFWLSLTGVSLAGAMGVKFVGL
FVVLLVGLNTIYDLWDLLGNLSLSLVMFGKHLLARVLCLIVLPLALYTAVFAVHFAVLNR
SGPGDGFFSSAFQSQLIGNNLHNVSIPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGIG
ARQQQVTAYLHKDLNNLWIIKKHDSDTDLSDPSGPVEFVRHGDIIRLEHKETSRNLHSHQ
HEAPLTRKHFQVTGYGINGTGDSNDFWRIEVAGRRTGELIKVLRSQVRLTHVATGCILGS
SGKTLPKWGWEQVEVTCTPYLKETPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHM
VMIRGNSGLKPKDNEVTSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLVTIGL
YLLITVATAVALKRGVQLTSELKELSRVVLHAGGQITLGWLLHYLPFFMMGRVLYFHHYF
PAMLFSSMLTGITWDALLKFCAGLLSPSTTARRVYGGGFLALVLLILYSFYLFHPLSYGM
IGPLASNPSSPMAGLRWMDSWEF
Download sequence
Identical sequences H0ZPX0
ENSTGUP00000012653 59729.ENSTGUP00000012653 ENSTGUP00000012653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]