SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZPX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZPX4
Domain Number 1 Region: 721-836
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-35
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 2 Region: 177-279
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-34
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 3 Region: 558-662
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-33
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 4 Region: 1-107
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 5 Region: 380-491
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-18
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 6 Region: 317-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 842-902
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000756
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 496-555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 9 Region: 113-174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000553
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 10 Region: 667-733
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000688
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 900-935
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000628
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZPX4
Sequence length 937
Comment (tr|H0ZPX4|H0ZPX4_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000012657} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLSLYDG
HPHPANFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGNPGVP
PKGILYGQRFDVGDKIRYSCVTGYILDGHPQLTCIASSVSTASWDFPVPICRAEDACGGT
MRGSSGIITSPNFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGSEPPT
IGLSGMNIPPPVISNKNWLRLHFVTDSNHRYRGFSAHYQVKKAIDFKSRGFKLFPGKDNS
NKFSILNEGGIKQASNLCPDPGEPENGKRIGSDFSLGATVQFSCDEDYVLQGSKSITCQR
IAEVFAAWSDHRPVCKVKTCGSNLQGPGGTFTSPNFPFQYDSNAQCVWVITAINTNKMLK
PLVFPKIVLMKKYMKFSVGSSQKMGDPKTVLQVLTGSFVPDLIVSMSNQMWLHLQTDESV
GSIGFKVNYKEIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIICQEN
NQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFD
LESQFDFLAVKDGDSVDSPIIGTFTGAEVPSHLTSNGHILRLEFQADHSMSGRGFNITYN
TFGHNECPDPGVPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCMLVDGKVMWSGP
IPKCGAPCGGHFSSPSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYD
VLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFMYLLFTTDNSRSNNGFKIHYESVTVNT
YSCLDPGIPVHGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHPLPTCDALC
GGDVRGPSGTILSPGYPDLYPNSLDCTWTVDVTHGKG
Download sequence
Identical sequences H0ZPX4
ENSTGUP00000012657 ENSTGUP00000012657 59729.ENSTGUP00000012657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]