SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZQF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZQF8
Domain Number 1 Region: 644-698
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000193
Family Tudor domain 0.00008
Further Details:      
 
Domain Number 2 Region: 277-338
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000129
Family UBA domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZQF8
Sequence length 741
Comment (tr|H0ZQF8|H0ZQF8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000012846} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=TDRD3 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MAERARAALSESGWCLSDEGIEACLSSSEKVNTNDIILVALNTDLRTIGKKFLPSDINGG
KVEKLEGPCVLQIQKIRNVAAPKDNEESQAAPRMLRLQMTDGHTSCTAIEYSSMSKISLN
TPPGTKIKLSGVVEVRNGFLLLDDSNTAVLGGEVEHLIEKWELQRSLAKHNRSNIGTEGG
PPPFVPFGQKCASYVQVDSRDLDRRKTLQMTNAVKPVADNDEFEKQRTAAIAEVAKSKET
KTFGGGGGSSRSNLSVSTGGNRNRELFQKEKIAKPEGKNEGVYRELVDEKALKHITEMGF
SKEAARQALMDNSNSLEAALNFLLNNSKQKPIQGPPPRGKGKGRGRIRPEDEEELGNARP
SAPSTLFDFLESKMGTLTVEEPKLQFQPTHQVQHKVMNTEQNGIKENHSRHVSRNDMRQP
RNEKPPRFQKDFQNSRQALESGGLPRNRGPERHSSLEHWTDEKNKSDRHYPRNDRSKDLS
YPISTHQSDSTFKKRDNNMQNRVGKGVSFSEFKENSAAQDVTENNNQKRGKRENQTHNSE
NFCDRKARTISTEAFMVKREQHFGVNNDYQNPSRTDNFSAVPNGDTEHHQKGRRVGPIKS
SGPTAIPSFDDKMLYYNTGPKRRTGPIKPEKILEPSSHMEYGKSWRPGDECFALYWEDNK
FYRAEIEALHSSGTTAVVKFSDYGNYEEVLLSNIRPVHADTWEEEEETYEQTLEFRRGGD
GQPRRSTRPTQQFYQPPRARN
Download sequence
Identical sequences H0ZQF8
ENSTGUP00000012846 59729.ENSTGUP00000012846 XP_012425243.1.42559 ENSTGUP00000012846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]