SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZQU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZQU6
Domain Number 1 Region: 720-837
Classification Level Classification E-value
Superfamily SEA domain 8.37e-20
Family SEA domain 0.0071
Further Details:      
 
Domain Number 2 Region: 228-287
Classification Level Classification E-value
Superfamily SEA domain 0.00000000379
Family SEA domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZQU6
Sequence length 919
Comment (tr|H0ZQU6|H0ZQU6_TAEGU) Interphotoreceptor matrix proteoglycan 1 {ECO:0000313|Ensembl:ENSTGUP00000012987} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=IMPG1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MHLKTGLIFLIICLALQVQGSREIPDKINRAEAKHLAVASGSDKTERTTKRSRISTIRRI
FDMAKHRTKRSSFFSTGVKVCPQESVKQILASHQAYYRLRVCQEAVWEAFRIFLDRIPDT
SEYQNWVTACQRETFCIFDIGKNFSNSQEHLEIIQRRVKHRTFQERKDEISAEKTGGKKV
EDIPSISTGSPGTPISPSAPNGTLLNEIFNDTKTPVKELGTNAVPELPVEQMVEFSVTLT
DQEYTAELSDPSSPEYQQLAAKFQLQMKKIFEKLPGFKEIRVLGFKKRIVEQSSSTIARY
VVNFERDGSETKGTADDVSTIGSNKVESEKIPISPVEEREISATKLTVTDLQQLVATALH
EDQSLPVDLGTLQFTDETVIQPSDLDNDIQGVVTIPLAGPDLDECCVEELPLGYPSPATV
DQRGDVFVDEFTTESPALSEEISIPEEFNNFITSEPDFPTKPSREPFQDRYPYTQVIATD
HPGFTVPFSALGSTSSPPKSEDSYLPPPADDSAGKDLLTGGYESPVELATAGSFTTPHLL
PAGEVEKEADEKQELTDITEPPFKDVDQDSLSGQAIKIMEEPESSGDDIFVTASTYERLP
FFTGPSDVSTAQPGAVITDVLPSVAPLPAATSPSYSPSEIIEQSLELPGPSAPAPEGVPA
DGTGMGVQDIAAELDPMGAVSTATLDEGEQGSGYIPGLTTEPAETTPAPVLKYVTTSSMT
TAAKGKELVVFFSLRVTNMHFSDDLFNRSSTEYKALEQQFMQLLLPYLQSNLTGFKHLEI
LNFRNGSVIVNSKMKFAKTVPYNITEAVHCVLEDFCDAAAQHLNLEIDSYSLDIEPADQA
DPCKFMACDKFSECVLNEWTREADCLCKPGYASRDGLPCRSLCELQPHLCVNGGKCELVP
GRGAVCRSPDEFTKPRLTS
Download sequence
Identical sequences H0ZQU6
59729.ENSTGUP00000012987 ENSTGUP00000012987 ENSTGUP00000012987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]