SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZR71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZR71
Domain Number 1 Region: 19-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-31
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZR71
Sequence length 878
Comment (tr|H0ZR71|H0ZR71_TAEGU) Collagen type IX alpha 1 chain {ECO:0000313|Ensembl:ENSTGUP00000013113} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=COL9A1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
DICPTIRIGQDDLPGNCCFDLISQFQIEKAASQGIIERVVGSTSLQVAYKLGPNVDFRIP
TSAIYSNGLPDEYSFLTTFRMTGATLQKYWTIWQIQDSSGKEQVGVNLNGQMKSVEFSYK
GADGRHQTASFLHLPFLFDSQWHKLMIIVEANSVTLFIDCIKIESLNIKPKGKINTDGFA
VLGKLKNNPQISVPFEIQWMVIHCDPLRPQREGCGELPARVRNLPWAGSRGPPGPPGPPG
PPGPPGVPGIDGVDGERGPKGPPGPPGPDGDAGKPGSPGLPGEPGADGFTGPDGSRGAPG
PKGQKGEPGQPGARGLPVIYGIWGKNGPAGAAGLPGEVGLAGPPGDPGKRGPPGLPGPPG
PPVSDIFNVGKGICPSACPPGRPGHAGLMGMKGQKGSKGESGEPGKQGYKGEEGDQGPSG
EVGAQGPPGILGIRGITGIMGPKGTKGARGLDGDPGPQGLPGAPGDQGQRGPLGEAGPKG
ERGPQGTRGINGLPGTKGEPGLPGVDGREGIPGMPGAKGEPGKPGAPGDTGLQGLPVRES
IHNARGNSALRGNRGPPGVPGLMGNPGKQGQQGPEGEAGPTGPRGPPGSRGETGPAGPPG
LPGKLGPQGSIGLPGLPGPPGLPGSKGDRVRNALYRPLKNHATTDSSCLLKKKIYIEQLH
FGSHFFAFVGNPGDPGSRGPEGSRGLPGMEGPRGLPGPRGLQGEQGAPGLPGSEGPAGKE
PSDQHIKQVCMRVMQEQLAQLAASLRRPEFGAPGLPGRPGPPGAPGPAGENGFPGQLGPR
GLPGLKGPPGEIGRKGPKGEPGERGERGFPGRGLKGHPGPRGLPGEPGKASYGREGRDGD
RGPPGVAGQPGVPGPPGPPGPPGYCEPASCRMQAGQRA
Download sequence
Identical sequences H0ZR71
ENSTGUP00000013113 59729.ENSTGUP00000013113 ENSTGUP00000013113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]