SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZR99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZR99
Domain Number 1 Region: 203-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000105
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 329-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000349
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 140-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000219
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 4 Region: 20-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000036
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 58-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000406
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 100-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000785
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  H0ZR99
Domain Number - Region: 177-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.0056
Further Details:      
 
Domain Number - Region: 3-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00326
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZR99
Sequence length 397
Comment (tr|H0ZR99|H0ZR99_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000013142} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LQRYQCDCLSGWEGKFCEKESNECNSEPCRNNGTCMDLFNSYRCTCTAGWTGPDCSEDIN
ECESEPCLNGATCFESVKPGQFVCICPPFYTGDFCHQRFSPCELPYNPCINNSTCLAQVD
GSPMCICKTGFEGTYCEVNSDECISHPCQNGGLCVDGVNHYRCSCQHGFTGTLCEVEINE
CLSRPCKNNGTCLDLLNRFICNCAPGYYGSLCEMDVNECETLPCLHGGSCINRLGGYRCL
CLLGFTGHRCEVNIDECMSSPCLNNGSCIDGISSYKCHCKQGFTGTNCEININECLPNPC
LHGSRCIDLIDGYQCSCEPGWTSSRCEININECESAPCINGGSCQDAINAFVCVCLSGYT
GRFCEVDVDVCSESTLNSVLCYNGGVCVDGPGRTFNC
Download sequence
Identical sequences H0ZR99
ENSTGUP00000013142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]