SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZSU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZSU5
Domain Number 1 Region: 320-489,529-614,657-685,747-854
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.85e-85
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00076
Further Details:      
 
Domain Number 2 Region: 175-282
Classification Level Classification E-value
Superfamily RING/U-box 8e-37
Family Zf-UBP 0.00000118
Further Details:      
 
Domain Number 3 Region: 705-765
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000245
Family UBA domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZSU5
Sequence length 856
Comment (tr|H0ZSU5|H0ZSU5_TAEGU) Ubiquitinyl hydrolase 1 {ECO:0000256|SAAS:SAAS00003083} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=USP5 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MAELSEALLSVLPSIRVPKAGDRVHKDECAFSFDTPESDGGLYICMNTFLGFGKQYVEKH
YQKTGQRVYLHLKRTRKPKEEDTNSSAGDPPRKKPTRLAIGVEGGFDITEEKFEYDEDVK
IVILPDHLDIPRDGLEGLPDMVKDRIASAIEAILTADSASRKQEVQAWDGEVRRVSKHAF
SLHQLQNDVRIPPCGWKCSKCDMKENLWLNMTDGAILCGRRYFDGSGGNNHAVEHYRETG
YPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLAHFGIDMLKMQKTDKTMTELEIDMN
QRIGEWELIQESGVQLKPLYGPGYTGIRNLGNSCYLNSVMQVLFSIPDFQRKYVDKLEKI
FQSAPSDPTQDFSTQVAKLGHGLLSGEYSRPASADGEQQSDQKGMQNGIAPRMFKSLIGK
GHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFRFLVEEKLKCLATEKVKYTQRV
DYIMQLPVPMDAALNKDELLEYEEKKRQAEEEKQPLPELVRAKVPFSSCLEAYGAPEQVD
DFWSTALQAKSVALKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISALQ
GTGLQEGEEEMPDIAPPLVTPDEPKGSLGFYGNEDDDSFCSPHFSSPTSPMLDESVIIQL
VEMGFPMDACRKAVYYTGNSGWVEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTIACPDP
PSEDSVATIVSMGFSRDQAMKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAAE
SISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKDGRWVIYNDQKVCASEK
PPKDLGYIYFYQRIPS
Download sequence
Identical sequences H0ZSU5
ENSTGUP00000013691 ENSTGUP00000013691 XP_002196564.1.42559 59729.ENSTGUP00000013691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]