SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZTK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZTK0
Domain Number 1 Region: 166-447,544-648
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.67e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0014
Further Details:      
 
Domain Number 2 Region: 11-73
Classification Level Classification E-value
Superfamily UBA-like 1.71e-24
Family UBA domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZTK0
Sequence length 1075
Comment (tr|H0ZTK0|H0ZTK0_TAEGU) Ubiquitin specific peptidase 25 {ECO:0000313|Ensembl:ENSTGUP00000013946} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=USP25 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MRADGEFVEEKATSRHQQTFLNQLREITGINDIQVLQKALKDSNGNLELAVAFLTAKNAK
VPQLEEATYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESNRAFRET
GITDEEQAISRVLEASIAENKASLKRTHPEVWSDSPNPYDRKRQDNCPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNFNPPANAQDLPRNQKEHRNLPFMRELRYLFALLVGSKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQIKAEEERDGEKPKNPMVELFY
GRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSAKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPPILYLDRYMHKNREITRIKRDEIK
RLKEYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDLGASAPASG
TLPPQIPPSTIEQQGPSSSDVPSTSPVQRSVIHKPFTQSRIPPDLPMHPAPRHITEEELS
VLEGCLHRWRTEVENDTRDLQESISRIHRTIELMYSDKTMVQVPYRLHAVLVHEGQANAG
HYWAYIYDHHQNRWMKYNDISVTKSTWEELERDSFGGYRNASAYCLMYINDKEQYLIQEE
FNKETGQMLVGMDTLPSDLRDYVKEDNKRFEKELEEWDAELAQKAQQEKLLSQIPRAPAP
SPAPVQAGEPEYLEQPSRTDISKHLKEDSVQAINKALAEQEDRGPEAIMDTKLCTTVMGV
VQKIAKTLRNVLNVCAFLPAIKLEYTRLLKLAQEDPPPECDYRLRHAIVYFIQNQAPKKI
IERTLLEQFGDHNLSFDERCRNIMKVAQAKLEMIKPDEVNMEEYERWHQDYRHFRETTMF
LMVGLEFFQKKSYMEALLYLIYAYQNNKELLSKGPYRGHDEELISHYRRECLLRKKKQNS
YLEAGGTWMLHLMLLFLHFSYMEALLYLIYAYQNNKELLSKGPYRGHDEELISHYRRESN
LQEKLTDFLPKLLDCSTEIKGFNDPPKLPSYSTHELCERYARIMLSLSRTPADGR
Download sequence
Identical sequences H0ZTK0
ENSTGUP00000013946 59729.ENSTGUP00000013946 ENSTGUP00000013946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]