SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZV04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZV04
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-21
Family YWTD domain 0.00046
Further Details:      
 
Weak hits

Sequence:  H0ZV04
Domain Number - Region: 145-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZV04
Sequence length 179
Comment (tr|H0ZV04|H0ZV04_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000014451} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LOC105759888 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
KLFFTDYGNAAKVERCDMDGTNRTWIVDSKIEQPTALALDLINKYVYWLDIYLETVEVVD
YQGRRRQTITKGRQIRHLSGLAVFENYLYTINSDNLSILRIDRYNGTDVQALARLDNAKE
IRVYQKRTQAAARSHACEPDPSGTPGGCSHICLLGSSHKARTCRCRTGFILATDGRSCK
Download sequence
Identical sequences H0ZV04
ENSTGUP00000014451 ENSTGUP00000014451 XP_012431663.1.42559 59729.ENSTGUP00000014451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]