SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZVF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZVF9
Domain Number 1 Region: 40-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 2 Region: 110-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  H0ZVF9
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZVF9
Sequence length 153
Comment (tr|H0ZVF9|H0ZVF9_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000014606} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
RLQCDCTPHCGGSCDRCCPGYNQFPWKPATADSANECQPCNCNGHAYDCYYDPEVDRHKA
SRSREDKFEGGGVCIDCQHHTTGINCERCIPGYYRSPDHPIDSPYVCYRCNCESDFTDGT
CEDLTGRCYCKPNFTGEHCQACAEGYLNFPHCY
Download sequence
Identical sequences H0ZVF9
ENSTGUP00000014606 ENSTGUP00000014606 59729.ENSTGUP00000014606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]