SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZXA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZXA3
Domain Number 1 Region: 13-75
Classification Level Classification E-value
Superfamily Chromo domain-like 1.59e-23
Family Chromo domain 0.000059
Further Details:      
 
Domain Number 2 Region: 103-138
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000113
Family Chromo domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZXA3
Sequence length 138
Comment (tr|H0ZXA3|H0ZXA3_TAEGU) Chromobox 1 {ECO:0000313|Ensembl:ENSTGUP00000015254} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=CBX1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQSQKTAHESEKSEGSKRKAESDTEDKGEESKPKKKKEESEKPRGFARGFEPE
RIIGATDSSGELMFLMKW
Download sequence
Identical sequences H0ZXA3
59729.ENSTGUP00000015254 ENSTGUP00000015254 ENSTGUP00000015254 XP_002192420.1.42559 XP_010200398.1.23224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]