SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0ZXG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZXG0
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily L domain-like 0.000000408
Family Ngr ectodomain-like 0.089
Further Details:      
 
Weak hits

Sequence:  H0ZXG0
Domain Number - Region: 80-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00573
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZXG0
Sequence length 156
Comment (tr|H0ZXG0|H0ZXG0_TAEGU) All-trans retinoic acid induced differentiation factor {ECO:0000313|Ensembl:ENSTGUP00000015311} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=ATRAID OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LDLSNCSLHSVPPGLAEATTAMVLDLTENPLTALPSGSFLGFIHLQSLAVPLTLQCPGGR
DAWQNVTVDRSSRLCQGQRNPCNSSVELAWPCPENSVCAPDGPGLIQCLCDSPFHGYKCL
REGPFPMLLFGGILGTVTVSLSLLLWRTQRRKAKTP
Download sequence
Identical sequences H0ZXG0
59729.ENSTGUP00000015311 ENSTGUP00000015311 ENSTGUP00000015311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]