SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZXN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZXN8
Domain Number 1 Region: 89-154
Classification Level Classification E-value
Superfamily UBA-like 4.08e-20
Family UBA domain 0.0014
Further Details:      
 
Domain Number 2 Region: 165-215
Classification Level Classification E-value
Superfamily UBA-like 6.38e-17
Family UBA domain 0.0056
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000242
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZXN8
Sequence length 244
Comment (tr|H0ZXN8|H0ZXN8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000015389} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
VSFRTTRFASFPDYLVIQIKKFTFGDWVPKKLDVSIEMPEELDISALQGTGLQEGEEEMP
DIAPPLVTPDEPKGSLGFYGNEDDDSFCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRK
AVYYTGNSGVEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTIACPDPPSEDSVATIVSMG
FSRDQAMKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAAESISESVPVGPKVR
DGPG
Download sequence
Identical sequences H0ZXN8
ENSTGUP00000015389 ENSTGUP00000015389 59729.ENSTGUP00000015389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]