SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZXV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZXV8
Domain Number 1 Region: 58-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-29
Family Calnexin/calreticulin 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZXV8
Sequence length 199
Comment (tr|H0ZXV8|H0ZXV8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000015460} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MHFQWDWLCLGVLIISSVTAGMENKENLDADVEVENFDKQSQEADVDRDKSSLEVVYQTP
KPTGEVYFTETFDEGLSGKAVISLLQTAFFKDSVHVCGRWEVEELKENALPGDRGLVLKS
VAKYHAISSMLTKAFVFEDKPLIVQYEVNFQKGIDCGGAYIKLLSSSNDLNLLGTFFDKH
LKLIMFGPNRGGEHYTLHF
Download sequence
Identical sequences H0ZXV8
ENSTGUP00000015460 ENSTGUP00000015460 59729.ENSTGUP00000015460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]