SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZXX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0ZXX9
Domain Number - Region: 65-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0738
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZXX9
Sequence length 122
Comment (tr|H0ZXX9|H0ZXX9_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000015481} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SSTRPEAASIEPLGPAGCLCSQRALVQARSSQPTRLTTIISAEDTLTGQVLRCDAIVDLI
HGIQVVSTMRELYLEDSPLELKIHALDSEGNTFSTLAGLVFDWTLVKDPEPDGFSDSHNT
LR
Download sequence
Identical sequences H0ZXX9
ENSTGUP00000015481 ENSTGUP00000015481 59729.ENSTGUP00000015481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]