SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZY32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZY32
Domain Number 1 Region: 27-86
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.05e-17
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZY32
Sequence length 87
Comment (tr|H0ZY32|H0ZY32_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000015534} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
IDFDLILENIKDLNSLVGEGIPQIVHTPRGARLGRPEPLPLTLYRNGIVVGHGAFRPYQH
PATQQCLQDIMDGYLPSELQPRYPDGV
Download sequence
Identical sequences H0ZY32
ENSTGUP00000015534 59729.ENSTGUP00000015534 ENSTGUP00000015534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]