SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZZ06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZZ06
Domain Number 1 Region: 14-73,108-226
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.12e-41
Family YicI catalytic domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZZ06
Sequence length 226
Comment (tr|H0ZZ06|H0ZZ06_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000015859} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
PGTYRPYELGQEMGVWVNNSDGVTPALGQIWPPGYSVFPDFTNPRTVEWWTTLCLEFKDV
LDYDGIWIDMNEPANFMRGQLPGCADTEINNPPYTPSITDRSLAEKTLCPDSKTYLGDHY
NTHSLFGWSQTEPTFNVVQQATGKRAFVLARSTFVGSGKHGGHWLGDNFSLWKDLHHSII
GILEFNLFGIPYVGADICGFNYNTTYELCLRWMQLGSFYPFSRNHN
Download sequence
Identical sequences H0ZZ06
ENSTGUP00000015859 ENSTGUP00000015859 59729.ENSTGUP00000015859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]