SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZZ67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZZ67
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Cupredoxins 8.32e-36
Family Multidomain cupredoxins 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZZ67
Sequence length 112
Comment (tr|H0ZZ67|H0ZZ67_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000015920} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
GLLGPTLHAEVGDTLVVHLKNMADKPVSIHPQGLVYSKNEEGSLYDDRTSSAEKRDDAVL
PGQLYTYVWDISEEVGPGEADLPCLTYAYYSHENMAMDFNSGLIGALLICKK
Download sequence
Identical sequences H0ZZ67
59729.ENSTGUP00000015920 ENSTGUP00000015920 ENSTGUP00000015920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]