SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZZA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZZA4
Domain Number 1 Region: 17-230,300-359
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.07e-35
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 354-400
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000129
Family SOCS box-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZZA4
Sequence length 401
Comment (tr|H0ZZA4|H0ZZA4_TAEGU) WD repeat and SOCS box containing 2 {ECO:0000313|Ensembl:ENSTGUP00000015957} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=WSB2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
PAAEEPVLLAELKPGRPQRYDWKSSCETWSVAFSPDGAWFAWSQGHCVVKLIPWPLGEAE
LGCKTSERKSRGSKAETWSRGAAKEKTLECGQIVWGLAFSAWPAAEDGDTDPACAVGLPC
LVLATGLNDGQIKVWEVQTGHLLFSLLGHQDVVRDLSFAPNGSPILVSASRDKTLRVWDL
SRDGRQVQVLSGHVQWVYCCSISPDCSMLCSAAGEKSVSPAGWEPSLCLLNPALFGEHSS
WWSGPWDHHGLAVTRSGPRHSELRSMSSWQRTVLPGTLLWEANPSSSCVFRGSQRLHFGS
RHCTVSSPFLHRLLRIWALELRSPVAFAPMTNGLCCMYFPHGGFIATGTRDGHVQFWTAP
RVLSSLKHLCRKALRTFLTTYQVLALPIPRKLKEFLTYRTF
Download sequence
Identical sequences H0ZZA4
59729.ENSTGUP00000015957 ENSTGUP00000015957 ENSTGUP00000015957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]