SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A0R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A0R8
Domain Number 1 Region: 14-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000407
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A0R8
Sequence length 44
Comment (tr|H1A0R8|H1A0R8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000016477} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SVFPAAPVAAAVRSHFHECPDSHRQFCFHGTCRFLVQEEKPACV
Download sequence
Identical sequences H1A0R8
59729.ENSTGUP00000016477 ENSTGUP00000016477 ENSTGUP00000016477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]