SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A1B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A1B7
Domain Number 1 Region: 41-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 3-80,122-162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000722
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A1B7
Sequence length 163
Comment (tr|H1A1B7|H1A1B7_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000016679} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
ISNQCSPLPCHKDGYKDCIDGQAKYTCVCKAGWRGENCEEDINECEDFNGGCSQRCSNFP
GSFRCLCEDGYFMHSNKRDCGGRETSGEPPSLPAQCLLTRGREGKERGSNYSSLLELHKA
CFDIDECAENICAQLCVNSPGSYSCYCDGKKGFKLSKDMKNCE
Download sequence
Identical sequences H1A1B7
ENSTGUP00000016679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]