SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A1K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H1A1K0
Domain Number - Region: 15-107
Classification Level Classification E-value
Superfamily MIR domain 0.034
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1A1K0
Sequence length 123
Comment (tr|H1A1K0|H1A1K0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000016762} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
YLASDHKTFRDFAKKSRLQKVFLTAELSYLTFWQAKSLDPQLRLEHEGFPVPAETKIIIT
HCYTNRNLAVPRTFCVWSHFGREFEVICHNYLDSRRVEEDKNHWEIITGNPGPEDGTMLE
RPK
Download sequence
Identical sequences H1A1K0
ENSTGUP00000016762 ENSTGUP00000016762 59729.ENSTGUP00000016762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]