SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A2Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A2Q7
Domain Number 1 Region: 72-315
Classification Level Classification E-value
Superfamily SET domain 7.59e-56
Family Histone lysine methyltransferases 0.00021
Further Details:      
 
Domain Number 2 Region: 3-38
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000403
Family Chromo domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1A2Q7
Sequence length 360
Comment (tr|H1A2Q7|H1A2Q7_TAEGU) Suppressor of variegation 3-9 homolog 1 {ECO:0000313|Ensembl:ENSTGUP00000017169} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=SUV39H1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
DEEFYLVKWRGYPSSANTWEPRRNLRCRGLLQQLHADLARAPGGPVRPGPRGLPARAVSY
LAQKAEQRRALRRWERHLNRTRSHRGRIAVENEVDLHGPPRDFVYVNEYKVGAGVALTPV
AAGCECRDCLAEATLAGGCCPGASRNRFAYNEAGQVRIRAGLPIYECNSRCRCGAECPNR
VVQRGIRYNLCIFRTGDGRGWGVRTLQRIRKNSFVMEYVGEVSVTDENAPGASHVRFVAK
APPIFNMKLMGAVSWIRWGFLPTGGRFTWAQCDPNLQVYNVFIENLDQRLPRIALFATRP
IRAGEELTFDYNMHVDPVDAESTRMDSNFGLVGGSLGGSPRARGRIECKCGAASCRKYLF
Download sequence
Identical sequences H1A2Q7
ENSTGUP00000017169 ENSTGUP00000017169 59729.ENSTGUP00000017169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]