SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A371 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A371
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-29
Family C-type lectin domain 0.00000651
Further Details:      
 
Domain Number 2 Region: 404-470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.28e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 466-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.53e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 287-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 347-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 217-283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 529-593
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 603-676
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 661-724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000556
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 171-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A371
Sequence length 726
Comment (tr|H1A371|H1A371_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000017333} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
EVDAWTYHYSDQGDYTWEQARNFCQTFFTDLVAIQNQQEIEYLNKSLPYHGRYYWIGIRK
LGSTWTWVGTQKALSKEAENWAEGEPNNRRSNQDCVEIYIQRPQQSGKWNDEPCNRKKKA
LCYRASCQPFSCSQRGECVETIGSYRCECYPGFHGPECADVLQCAKLEPKGVPMNCSHPY
GDFSYNSTCEFGCHKGFERQGAGVLRCLPSQEWSANIPTCTAVTCPVLRAPDQGEMNCSH
LHGDFSFGSTCAFSCQKGFVLMGPESRECTATGIWTGDATRCEATACPVLSAPDQGEMNC
SHLHGDFTFGSTCAFSCQKGFVLMGPESRECTATGIWTGDATRCEAISCPVLSAPDQGEM
HCSQIHGNFTYGSMCAFSCQTGFALVGLQSRECTALGTWTGDTPHCEAVTCPVLRAPDQG
ELNCSHLHGDFSFGSTCAFSCQKGFVLMGPESRECTATGIWTGDAPRCEAVTCPVLRAPD
QGEMNCSHLHGDFTFGSTCAFSCQKGFVLMGPESRECTATGIWTGDATRCEAITCPVLRA
PDQGELNCSHLHGDFTFGSSCAFSCQTGFVLIGSDRRKCTATETWTGDAPRCEGRAVATA
QAIKCSALTTPKMGQATCFHLHGDFTFGSTCAFSCQVGFVLMGSESRECTALGTWTGNPT
HCKAISCPVLSPPSRGQLSCSHVHGNFTYNSTCTFSCEEGFVRMGAEMLQCEATGNWTRD
PPVCAG
Download sequence
Identical sequences H1A371
ENSTGUP00000017333 59729.ENSTGUP00000017333 ENSTGUP00000017333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]