SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A399 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H1A399
Domain Number - Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000238
Family Laminin-type module 0.04
Further Details:      
 
Domain Number - Region: 36-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Laminin-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A399
Sequence length 64
Comment (tr|H1A399|H1A399_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000017361} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CHHVTGECSCPPGWTGHDCKHPCSSGRWGRGCANSCACQGGDGGCDPATGTCSCQPGFTG
QHCQ
Download sequence
Identical sequences H1A399
ENSTGUP00000017361 ENSTGUP00000017361 59729.ENSTGUP00000017361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]