SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1A3C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A3C9
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-18
Family Ubiquitin-related 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A3C9
Sequence length 150
Comment (tr|H1A3C9|H1A3C9_TAEGU) Transmembrane and ubiquitin like domain containing 1 {ECO:0000313|Ensembl:ENSTGUP00000017391} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=TMUB1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
PAEPTLVLRLKFLNDTERLARVRPGDTVGALKRTYFPGQEQQVRLIYQGQLLRDDAQSLA
GLHLGHLSVLHCHLSPPSAAPTAPGTPGPRSPAPAALGVGSLALPLFVLLLALLWYLQLQ
HRHVFTATATTCLAGLTLLVTFVAFAMYRR
Download sequence
Identical sequences H1A3C9
ENSTGUP00000017391 ENSTGUP00000017391 59729.ENSTGUP00000017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]