SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1A550 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A550
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000433
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A550
Sequence length 109
Comment (tr|H1A550|H1A550_TAEGU) Neuregulin 4 {ECO:0000313|Ensembl:ENSTGUP00000018016} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NRG4 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
DHEELCGTSYGSFCLNGGICYMIPTVSSPFCRCIENYTGARCEEVLLPSIKSQTKGDLFA
AFLASLLLLGVLVIGAFYFLCRKVSIPRTNSSEYGANLVETTSSNGCNS
Download sequence
Identical sequences H1A550
59729.ENSTGUP00000018016 ENSTGUP00000018016 ENSTGUP00000018016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]