SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1A5F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A5F0
Domain Number 1 Region: 99-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000289
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 3-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000671
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 67-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  H1A5F0
Domain Number - Region: 35-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A5F0
Sequence length 137
Comment (tr|H1A5F0|H1A5F0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000018116} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
AQCEPPCEHGGTCLPHNTCSCAYGFVGPRCETMVCSRHCHNGGVCVSPDECQCRHGWSSP
SCETAVCNPVCLNGGVCVRPNTCSCPSGFYGPQCQRALCIPPCKNGGHCVRTNVCSCAEG
YTGRRCQKSELNISLCF
Download sequence
Identical sequences H1A5F0
59729.ENSTGUP00000018116 ENSTGUP00000018116 ENSTGUP00000018116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]