SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1GFW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1GFW8
Domain Number 1 Region: 107-268
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.14e-25
Family SMI1/KNR4-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1GFW8
Sequence length 270
Comment (tr|H1GFW8|H1GFW8_LISIO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:EHN60010.1} KW=Complete proteome OX=1002366 OS=Listeria innocua ATCC 33091. GN=HMPREF0557_02926 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MLTTRKALYYLDKGKTKEAIHLLETCWNQKVTAENKRDIFTATVLLSDVLYQSGERFPEI
YQKLMSILEEMQDLEAVDFEREKAKQIFAELDEYFSEVGTFFQGHSLAELWLKFDSENDY
KDVYPTPQRVAAIEAELGYKLPKSYIYLMRHTQNGGIVSTGSVPTTEPSSWSENCVAITG
IMGIGDCGVSTLNGMHNTNFWTEEWGYPDVGLAIADCPSAGHDMVFLDYRNCGKTGEPAV
VHIDQEGDYKILKLADNFEEFILSLYREEY
Download sequence
Identical sequences H1GFW8 Q927J5
WP_003772917.1.46653 WP_003772917.1.99521 368053 gi|16801854|ref|NP_472122.1| 272626.lin2793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]