SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1QI18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1QI18
Domain Number 1 Region: 7-194
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.53e-16
Family Aclacinomycin methylesterase RdmC 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1QI18
Sequence length 211
Comment (tr|H1QI18|H1QI18_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:EHN75932.1} KW=Complete proteome OX=1120227 OS=Streptomyces coelicoflavus ZG0656. GN=SMCF_4597 OC=Streptomyces.
Sequence
MTEAVETDAGAARITWHRARDPRLVLAVSHGAGGGIEARDLKALAAALPAHGVSVALVEQ
PWRVAGKKLAPAPKTLDTGWRGVWPALTAPGPPVISGGRSAGARVACRTAGELGARAVLA
LSFPLHPPGKPEKSRAAELLGAGVPTLVVQGGNDPFGRPREFPEEPEGAYDLIEVPYGDH
GFAVPKRAETTQEQALETITDGVLKWIGALG
Download sequence
Identical sequences A0A0N0YTF4 H1QI18
WP_007444527.1.4903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]