SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1UUN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1UUN5
Domain Number 1 Region: 124-264
Classification Level Classification E-value
Superfamily TPR-like 0.0000254
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1UUN5
Sequence length 600
Comment (tr|H1UUN5|H1UUN5_DROME) FI18232p1 {ECO:0000313|EMBL:AEY64288.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14043-RA OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVIPKEILSDFKELYEKANRLVEEESRNDPPTDPFRSHYKARDVLIVLKKQLDDQLVSVQ
ASEEDGGQDDRCYHSLLAFVCRDLGRIYIYTEEQAEGEKMLNRCLELVTPFKECPEGIIP
FIGAINELSIVLASKEEYNKGLEILLEAEKIYEDFKASGLKPLAIQDVFNPPEEGQQSHE
AGPKELESLYTLVSFYMAQMYGHLGEPEKSAKCCHRTLHRQLESKTYDPIDFALNTATLS
QFYIGEKRFEEARHHLAAATLIMAEYEVHMLEPEMSEKQRQDVSETFKHRYADVARCWAK
YGLYLMNTSKLRLMRDEDDEDAKNLEIVLRNMRLVEAEQSRFPGLDLTACENRISCEYCL
TFDDAKLVFHFVNEWLDIAKDYYKAENEATEYSKIMQDYAEAYEHIAFFEENPENQAKMQ
KRRAKYLEDLLDLLDPIFYMKICRECWYGAGTAHAAVMDVRLDIIRATSTPAPEDIKKVN
QSCMKAIKHFESYVKSYLVKPPSEEWRPNMDVEEQRHMLYAHFHIGRIYYKLISGHPLQQ
LEHLTSCHTYYQRFDAGCQLHKEAAETLQGEIGVVREMLQLLPLKINTIKARLNKAGLTA
Download sequence
Identical sequences H1UUN5 Q9VMX1
FBpp0078634 NP_608886.1.81976 FBpp0078634 FBpp0078634 7227.FBpp0078634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]