SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H1WCP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1WCP4
Domain Number 1 Region: 9-210
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000155
Family YdeN-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H1WCP4
Sequence length 258
Comment (tr|H1WCP4|H1WCP4_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:CCE17326.1} KW=Complete proteome OX=376219 OS=Arthrospira sp. PCC 8005. GN=ARTHRO_1580008 OC=Microcoleaceae; Arthrospira.
Sequence
MDWLEFSDNWVLIPPKPKAIVHFLGGAFVASAPHITYRWLLEQLGLQGYAIIATPFINTL
DHGNMAREVLWTFEDGLEDLFAAQKLRRRGLPIYGIGHSMGCKLHLLIGSLFEVERAGNI
LISFNNYTARQSIPLVEQLSSVIDVEFTPTPQQTNSLVGDRYQVRRNLLIQFSKDNIDQS
SGLYQILNHRFPGLVTLQQLRGDHQTPLAQDISWPRGESFSPLDAIGQWFKHEVYKDLYQ
LRREVLQWLNPLSPVKNI
Download sequence
Identical sequences B5VXR5 H1WCP4 K1WCX0
WP_006622140.1.46202 WP_006622140.1.76044 WP_006622140.1.80319 WP_006622140.1.84087 WP_006622140.1.97340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]