SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2EP76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2EP76
Domain Number 1 Region: 541-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 120-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 57-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 497-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000317
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2EP76
Sequence length 588
Comment (tr|H2EP76|H2EP76_ORENI) Complement component C8 beta {ECO:0000313|EMBL:AEX20386.1} OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MLSMVIQSSAINLHSCLLHVTLSLVLLSNVAVATGSNEDPSSRQARSVGDPVVIHPVDCI
LSEWSAWSRCDICQKRKYRYAKVEQPSQFGGEQCNSHAREEEACNVPARYTCDSVPLCEG
FLCTRTGRCIPRTLQCNGEDDCGDMSDEDGCRKVPKPCRQEAEEYWGIENLAKGINILNS
NLEGVVLDNRYYAGSCLPHYIQDVRFRKPYNLQQYTFQTRGSYDFSLQAFESYSDYMDYT
MKERMSKTVVSFGFGIPGIVEFGFNYNDNKYSKSVKKLRSASGKTNSFVRAKAELELAQY
MLKTDDLMLHPEFLRRLRSLPQAYDYGEYRQIYRDYGTHYVTEAALGGDYEHTIILDKEK
LAKTEYSLEDYKNCVQAGLKVGANIFGVYVSVGFHGGSRDGLLNEMGEEKGTESEVEDFV
AIVRGGSSESISALLSKKLPTPELMRLWGEGVRFNPDFIRQTTRPLYELVTSRDFSHHAI
LKRNLKRALSEYLAEASPCRCAPCRNNGVAVLKGTKCDCVCPVGYTGRACEITNRKKEIA
IDGNWSCWGAWSSCSGGQKTRSRQCNNPLPSNGGMACTGLQQESTACF
Download sequence
Identical sequences H2EP76
NP_001269827.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]