SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2IHQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2IHQ4
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.66e-34
Family Thioltransferase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2IHQ4
Sequence length 111
Comment (tr|H2IHQ4|H2IHQ4_VIBSJ) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome; Reference proteome OX=1116375 OS=Vibrio sp. (strain EJY3). GN=VEJY3_10980 OC=Vibrionaceae; Vibrio.
Sequence
METIDKIKQQISENSILLYMKGSPKLPSCGFSSQASQALMACGEKFAYVDILQNPDIRAE
LPKYAQWPTFPQLWIEGELIGGCDIILEMFQKGELQPLIKEAAARAEGEAE
Download sequence
Identical sequences A0A1B1EDQ5 H2IHQ4
WP_014232550.1.13071 WP_014232550.1.14200 WP_014232550.1.16983 WP_014232550.1.18931 WP_014232550.1.37005 WP_014232550.1.50333 WP_014232550.1.59672 WP_014232550.1.84506 WP_014232550.1.88247 gi|375266211|ref|YP_005023654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]