SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2IK07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2IK07
Domain Number 1 Region: 46-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.98e-41
Family Glutathione peroxidase-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2IK07
Sequence length 181
Comment (tr|H2IK07|H2IK07_VIBSJ) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} KW=Complete proteome; Reference proteome OX=1116375 OS=Vibrio sp. (strain EJY3). GN=VEJY3_17421 OC=Vibrionaceae; Vibrio.
Sequence
MKGRIKNLVLLGLLSLSSTAFAASCPDILQGKQRLLNSTDEIDLCEQFKGKTLLVVNTAS
QCGFTPQFEQLESLYQTYKDKNFAVIGFPSNDFNQDKGSEENSAKICYLDYGVTFPMMAR
SSVMGSDANPVFSEISQQAGVTPRWNFYKFLINKDGKVIATFPSSTSPTSTTLTNMIEQQ
L
Download sequence
Identical sequences H2IK07
WP_014233749.1.13071 gi|375262649|ref|YP_005024879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]