SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2IMC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2IMC4
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.02e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 72-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.25e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2IMC4
Sequence length 205
Comment (tr|H2IMC4|H2IMC4_VIBSJ) Glutathione S-transferase {ECO:0000313|EMBL:AEX25044.1} KW=Complete proteome; Reference proteome OX=1116375 OS=Vibrio sp. (strain EJY3). GN=VEJY3_23176 OC=Vibrionaceae; Vibrio.
Sequence
MIKLHHLNQSRSKRIIWLLEELNVDYEVVPYTRDKVTFLAPPELKSVHPLGKSPVLEDDG
EIIIESGAITEYLIEKYGDGQLAPERGTKAHTQYLQWMHFAESSAILPILLKVFVSKEPS
QTEFLSGYADKETMSVLNYFEQALEEKTYLVEERLTGADIMMSFIVELVHKFGMSKHFPN
IESYGNQLATHEGFSKAEQLEVKYA
Download sequence
Identical sequences H2IMC4
WP_014234880.1.13071 gi|375263789|ref|YP_005026019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]