SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JLD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JLD7
Domain Number 1 Region: 98-261
Classification Level Classification E-value
Superfamily TPR-like 2.34e-25
Family BTAD-like 0.0048
Further Details:      
 
Domain Number 2 Region: 261-475
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.68e-23
Family Gluconate kinase 0.082
Further Details:      
 
Domain Number 3 Region: 659-826
Classification Level Classification E-value
Superfamily TPR-like 8.16e-18
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 4 Region: 795-924
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000759
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 5 Region: 4-95
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000122
Family PhoB-like 0.001
Further Details:      
 
Weak hits

Sequence:  H2JLD7
Domain Number - Region: 526-582
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000144
Family Transcriptional regulator IclR, N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JLD7
Sequence length 929
Comment (tr|H2JLD7|H2JLD7_STRHJ) Response regulator {ECO:0000313|EMBL:AEY86979.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_1704 OC=Streptomyces.
Sequence
MSIGFTLLGDVTIRSRGAELAPGSPRQRCVLALLLIDVNRPVSAQTLLTRVWGDDVPPRA
MASLYSYVSRLRALRSDPADAERWDIVRTPAGYVLRTDSSAVDLFRFRSLVEQARGANDP
REAEISYGRALALWQSEPLAGLRSPWLDAYRLTLAEEHQRARLDYYELLLNRGRHVDLVQ
PLAALAAEQPLDEQVAHLHMLALYRTGQPAAALTAYEQLRQRLVERLGTDPGPQLQQLHQ
RILVFDDALAAPAAEAPERRTPRQLPASPSGFVGRDDALRLLDAREGRADDTAPDVRVIA
GMAGVGKSWLALRWAHQHADEFPDGQLYAQLNGFSPSVRPTDPGDVLHLFLMALGAAESE
LPADTEGRAALYRTLMARRKMLVVLDNARDSAQVVPLLPGTPGCRTLVTSRNRLSSLKVR
AGADIVGLGVLSPAESSRLLASRAGDDRAASEPALRDIVRWCAGLPLALDIAAAHADGLP
GASLDQLAQDLRDPSARLDVLDTGDVSVSLRVLFAASHAALDAEPARAFGLLGLLPHQDV
SLAALAHFIERDPTRTLRTMRVLEEACLVRQHRPGRYQMHDLIRLYAEEQATGLTATQRD
RHTRRLVGFYVCTAQAAHRVLEPHRTAQDPPALGDPGPAPLAFGDTQAALAWFDAEYACL
QEVIAIAEQRGMRLELCRLTWALHTFRWRRGLFEESIRAWYTALDAATGLDDPSLTAHTR
QRLGVALAQAGRYDEALPHLDEALERFRADGGTAGLTRTHHSLAEVHVRINAYERALPHF
AQALEGYRALGDQVGESNILNGTGWALARLGRYASGEAHCLQALPLLQIHEDGEGQAATW
DTLAYIARRTGRTSRALDAYQQALTHFQAIGNANREADTWASLGDMHADAGEHDAARRAW
ATALALYRDQGRAAEAREVTERLAARTEP
Download sequence
Identical sequences H2JLD7
gi|386837794|ref|YP_006242852.1| WP_014670319.1.21199 WP_014670319.1.57224 gi|474980003|ref|YP_007690469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]