SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JLK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JLK8
Domain Number 1 Region: 61-313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-69
Family Protein kinases, catalytic subunit 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2JLK8
Sequence length 546
Comment (tr|H2JLK8|H2JLK8_STRHJ) Putative serine/threonine kinase {ECO:0000313|EMBL:AEY87050.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_1775 OC=Streptomyces.
Sequence
MTAPQALPYGEEGYSGLSRVRVCGAPSQAHLWAAPGETVGDGMRLRQSALAPFQCSAPVL
GGRYRLDDAIGSGGAGDVHRGFDLRLKRPVAVKVFRDGDAADREDGFHNEAVILARLRHP
GLVTVYDAGRHDGRAYLVMELIEGPTLKARIAAGRLAPGETAALGADLARALAHAHDAGI
VHRDVKPSNIILDASGRPHLTDFGISRLLDATTRTSTGTLVGTAAYLSPEQVLGQTVGPP
ADVYALGLVLLECVTSRLEYDGAPLEAAIARLHRRPELPDSLPEEFAALLGDMTALEPQA
RPSADDCVRTLAALAESNGPGAVPPTADVTSLVPEQVPAWADRTHPHASHAAGTAAPKTA
PARGRHLVVGTAAALAAAVAATVGVSDGSAHHEAPRAVSSPSAKADAPGASASSHEAAPS
HEAAPGHEAGSVPGRPSTREVPAARLQEPTPGQASSSAPAVPSREAATGTGAHGTTAPPS
HTTTPGTPGSGAASPSDTASHGKAGADPSGERSDKPRNAGKGHGKKDRKEPSDAASPVSS
PSAGSS
Download sequence
Identical sequences H2JLK8
WP_014670390.1.21199 WP_014670390.1.57224 gi|386837865|ref|YP_006242923.1| gi|474980074|ref|YP_007690540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]