SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JLQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JLQ8
Domain Number 1 Region: 215-401
Classification Level Classification E-value
Superfamily TPR-like 0.00000411
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2JLQ8
Sequence length 446
Comment (tr|H2JLQ8|H2JLQ8_STRHJ) Transcriptional regulator {ECO:0000313|EMBL:AEY88304.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_3030 OC=Streptomyces.
Sequence
MQPNTLLDAILDEAGISHAGLAAHVNQAGRARGLALRYEHTAVARWLKGQRPRGQVPDLI
CEVLAARLRRPVTLDDIGLGVPGEPSTPHAGSLGGFVERATALWRSDEQQRPHVLGAPAV
TGTPAVMPVWEWENPPEDVDVSRGGRHPVTTADIEMLRAARTHYEQMYRKAGGVATRTRI
VGFLNAEAAPLLRGSYTDATGRQLHRATGGLVAIAGICAYDSDAHGLAQRYFHQALRLAK
ASGDRGLGAYVIALLVNQSLFMREYRQAVAFAEAALRAAGRHITPALASDLYAMQAKAYA
HLGDSGSALSCIRRAETAAERIRRGYEPDETGYVQPGLVNVQVAEALLSLGELAAAREHA
AAAVDNPAHDRGRVHRLAMLSTIELRQGNADKAVATAVRMAEQARGMESQRLRDRLRAVR
EHLVRCGSAGTAEAAELIDGALRVPL
Download sequence
Identical sequences A0A101PYL7 H2JLQ8
gi|386839119|ref|YP_006244177.1| gi|474981329|ref|YP_007691795.1| WP_014671639.1.21199 WP_014671639.1.28171 WP_014671639.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]