SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JPF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JPF2
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000124
Family SinR domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 209-386
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000256
Family BTAD-like 0.061
Further Details:      
 
Domain Number 3 Region: 124-181,336-425
Classification Level Classification E-value
Superfamily TPR-like 0.00000016
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JPF2
Sequence length 428
Comment (tr|H2JPF2|H2JPF2_STRHJ) Regulatory protein {ECO:0000313|EMBL:AEY85875.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0598 OC=Streptomyces.
Sequence
MTPNEGLGAHIRRLRRAAGLSQEALARPNLSPSYISLLEAGKRLPSQEVLAQLAERLGCT
PRDLTGVIPEPDSVNLEIELSCAQLALRDGDSRAALDAFTALRAKLPAGEERKGLGFATE
LGIAQCLEQLGQLEQAVRGFESLLERCGEQGRGVLDRLGVAMLLCRCYRALGEVSRAVDV
AERALADADAAGLPPTVAQLELLSALIGVYCERGDLHRANFLAGEAMSRAKLMDDRRELG
GAYWTAGTALHRRGRSGEALELVRKAVALFAEVDDARAVARVRNAQAMVLLHADDPSPET
ARALLEQSAATLRALGGGLDVVDAETALGRAEVMLGRPEQAIRHAETALGLLGPDHPLER
ARVHLVLAAAHLLQDDHEAAQAAYGRGALLLEAAEAGRQAAFAWAELGEILEKSGESERA
VWAYRRAY
Download sequence
Identical sequences H2JPF2
gi|474978965|ref|YP_007689431.1| WP_014669223.1.21199 WP_014669223.1.57224 gi|386836690|ref|YP_006241748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]