SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JPI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JPI1
Domain Number 1 Region: 52-291
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000412
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Weak hits

Sequence:  H2JPI1
Domain Number - Region: 410-503
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00176
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JPI1
Sequence length 513
Comment (tr|H2JPI1|H2JPI1_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY85904.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0627 OC=Streptomyces.
Sequence
MRLRNLPSRAATSAVAATLLCSAALLHPAPATAAGGPRSSFTADPLTTWQTNGIVWSLAA
AHGVVYVGGTFDAVRPPEAKPGDREVPRRNFAAFDAVTGALLPCAPSFTGGAGTVRALKA
SPDGRVLYVGGSFSRVGSTGVASAVALNTADCSLRRDFRPAVSATVRAIDVTDRTVYLGG
DFGQVDGRTRKRIAAFTPEGDLRPFRADVDAPVRALSVVPSHEKIYAGGDFERVNGLRAH
SLVALNSTSGATERTFPDWLPPRSSVKSIAQDGTRFYVGAEGHGEGIFDGRIAGRLDNDR
MVWKDTCRGATQVVLPYQGVLYSASHAHDCRETPGGFPERHDRQHLLAQSPGDSRILHWF
PDTDEGTGEQIGPRALTVARGILWVGGEFTKVNGEPQQALTRFGAGPDTGAPAVPALSLA
AKRAGQVTLRWKASWDREEASLTYRLYRDGRLISRQTRSSTYWDRPSMSYTDSVGAGTRH
QYRIEVTDGTNTSPKSPPLQVTVPATKAGDTAK
Download sequence
Identical sequences H2JPI1
gi|386836719|ref|YP_006241777.1| gi|474978994|ref|YP_007689460.1| WP_014669252.1.21199 WP_014669252.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]