SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JQ97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JQ97
Domain Number 1 Region: 210-323,379-409
Classification Level Classification E-value
Superfamily TPR-like 0.0000158
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2JQ97
Sequence length 451
Comment (tr|H2JQ97|H2JQ97_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY90921.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_5654 OC=Streptomyces.
Sequence
MAAPNRPNIRLREVIDAIGCTYDALAKDVRRIAAENGEIIHTNKSAISHWVHGTRQPTGR
TGRYLAEALSRRAGRPVTLTEIGLRDPEVAVPDDPDPVVTVTDLGRADMERRRFLAVAAF
TTAGVAMPLAYDHEAASRILRARTGRALVGAEDVDVVRQITAAFSTADERLGGGHGLTTV
TAYLADTAAPMLRARFASEALRRAAFGAVAELAYLAGWKHHDLGHEGAAQRYYQVGYQLA
CEADPHGHAAWMMRALAHQALSLKQPHHCVDLVEGALSRGLGHVDGKTEALLHITHARAF
AAVNEKPAAARALLAAEDALLRNDGPQPSFSLVSGPAAGTIVSHTARTLTDLADHVGTEQ
QHRDALVRWDPVKYKRVHALTYADLGDSLAAQARADEAVAAWNQALTLMDGMTSDRTRKA
ITSIRSTLAVYQRRKVPGAAELARRAREALS
Download sequence
Identical sequences H2JQ97
WP_014674234.1.21199 WP_014674234.1.57224 gi|474983946|ref|YP_007694412.1| gi|386841736|ref|YP_006246794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]