SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JQM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2JQM4
Domain Number - Region: 126-193
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000111
Family PriA-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2JQM4
Sequence length 335
Comment (tr|H2JQM4|H2JQM4_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY92878.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_7611 OC=Streptomyces.
Sequence
MELEVAGRTVRLSSPDKVFFPERGFTKLDLARYYAAVGPGILRALRNRPTTLERYPDGVG
GEWFYQKRAPKGMPGWIPTAHITFPSGRSADEMCPTEEAAVVWAAQYGTLTFHPWPVRAT
DVDHPDELRIDLDPQPGTDYADAARAARELRAVLDEFGGLRGWPKTSGGRGLHVFVPIEP
RWTFTQVRRAAIAVGREMERRMPDRVTIKWWKEERGSRIFLDYNQTARDRTIASAYSVRP
RPHAPVSAPLRWEEVGVAEPRDFDLATMPARFTDLGDVHADMDDHAFSLDTLLELARQDE
HDHGLGDLPYPPEYPKMPGEPKRVQPSRARREPSP
Download sequence
Identical sequences H2JQM4
gi|386843693|ref|YP_006248751.1| gi|474985902|ref|YP_007696368.1| WP_014676163.1.21199 WP_014676163.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]